PDB entry 2h3j

View 2h3j on RCSB PDB site
Description: Solution NMR Structure of Protein PA4359 from Pseudomonas aeruginosa: Northeast Structural Genomics Consortium Target PaT89
Class: structural genomics, unknown function
Keywords: NESG, GFT NMR, STRUCTURAL GENOMICS, PaT89, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-05-22, released 2006-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein PA4359
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA4359
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h3ja1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h3jA (A:)
    msalqpsrsyritgyspaisngyrqrlfsmgllpgaalrvvriaplgdpiqvetrqtsla
    lrrkdlalltlvpld