PDB entry 2h3f

View 2h3f on RCSB PDB site
Description: Solution structure of the HIV-1 MA protein
Class: viral protein
Keywords: HIV-1 unmyristoylated MA protein, VIRAL PROTEIN
Deposited on 2006-05-22, released 2006-07-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2h3fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h3fA (A:)
    garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
    gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
    tgnnsqvsqny