PDB entry 2h3f

View 2h3f on RCSB PDB site
Description: Solution structure of the HIV-1 MA protein
Class: virus/viral protein
Keywords: HIV-1 unmyristoylated MA protein
Deposited on 2006-05-22, released 2006-07-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-25, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gag polyprotein
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12497 (0-130)
  Domains in SCOP 1.73: d2h3fa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2h3fA (A:)
  garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil
  gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad
  tgnnsqvsqny