PDB entry 2h3d

View 2h3d on RCSB PDB site
Description: Crystal Structure of Mouse Nicotinamide Phosphoribosyltransferase/Visfatin/Pre-B Cell Colony Enhancing Factor in Complex with Nicotinamide Mononuleotide
Class: transferase
Keywords: NMN, typeII phsophoribosyltransferase
Deposited on 2006-05-22, released 2006-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nicotinamide phosphoribosyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Nampt, Pbef1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99KQ4
      • modified residue (370)
    Domains in SCOPe 2.08: d2h3da1, d2h3da2
  • Chain 'B':
    Compound: Nicotinamide phosphoribosyltransferase
    Species: Mus musculus [TaxId:10090]
    Gene: Nampt, Pbef1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99KQ4
      • modified residue (370)
    Domains in SCOPe 2.08: d2h3db1, d2h3db2
  • Heterogens: NMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h3dA (A:)
    gshmnaaaeaefnillatdsykvthykqyppntskvysyfecrekktenskvrkvkyeet
    vfyglqyilnkylkgkvvtkekiqeakevyrehfqddvfnergwnyilekydghlpievk
    avpegsviprgnvlftventdpecywltnwietilvqswypitvatnsreqkkilakyll
    etsgnldgleyklhdfgyrgvssqetagigasahlvnfkgtdtvagialikkyygtkdpv
    pgysvpaaehstitawgkdhekdafehivtqfssvpvsvvsdsydiynacekiwgedlrh
    livsrsteapliirpdsgnpldtvlkvldilgkkfpvtenskgykllppylrviqgdgvd
    intlqeivegmkqkkwsienvsfgsggallqkltrdllncsfkcsyvvtnglgvnvfkdp
    vadpnkrskkgrlslhrtpagnfvtleegkgdleeyghdllhtvfkngkvtksysfdevr
    knaqlnieqdvaph
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h3dA (A:)
    efnillatdsykvthykqyppntskvysyfecrekyeetvfyglqyilnkylkgkvvtke
    kiqeakevyrehfqddvfnergwnyilekydghlpievkavpegsviprgnvlftventd
    pecywltnwietilvqswypitvatnsreqkkilakylletsgnldgleyklhdfgyrgv
    ssqetagigasahlvnfkgtdtvagialikkyygtkdpvpgysvpaaehstitawgkdhe
    kdafehivtqfssvpvsvvsdsydiynacekiwgedlrhlivsrsteapliirpdsgnpl
    dtvlkvldilgkkfpvtenskgykllppylrviqgdgvdintlqeivegmkqkkwsienv
    sfgsggallqkltrdllncsfkcsyvvtnglgvnvfkdpvadpnkrskkgrlslhrtpag
    nfvtleegkgdleeyghdllhtvfkngkvtksysfdevrknaqln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h3dB (B:)
    gshmnaaaeaefnillatdsykvthykqyppntskvysyfecrekktenskvrkvkyeet
    vfyglqyilnkylkgkvvtkekiqeakevyrehfqddvfnergwnyilekydghlpievk
    avpegsviprgnvlftventdpecywltnwietilvqswypitvatnsreqkkilakyll
    etsgnldgleyklhdfgyrgvssqetagigasahlvnfkgtdtvagialikkyygtkdpv
    pgysvpaaehstitawgkdhekdafehivtqfssvpvsvvsdsydiynacekiwgedlrh
    livsrsteapliirpdsgnpldtvlkvldilgkkfpvtenskgykllppylrviqgdgvd
    intlqeivegmkqkkwsienvsfgsggallqkltrdllncsfkcsyvvtnglgvnvfkdp
    vadpnkrskkgrlslhrtpagnfvtleegkgdleeyghdllhtvfkngkvtksysfdevr
    knaqlnieqdvaph
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h3dB (B:)
    fnillatdsykvthykqyppntskvysyfecrekyeetvfyglqyilnkylkgkvvtkek
    iqeakevyrehfqddvfnergwnyilekydghlpievkavpegsviprgnvlftventdp
    ecywltnwietilvqswypitvatnsreqkkilakylletsgnldgleyklhdfgyrgvs
    sqetagigasahlvnfkgtdtvagialikkyygtkdpvpgysvpaaehstitawgkdhek
    dafehivtqfssvpvsvvsdsydiynacekiwgedlrhlivsrsteapliirpdsgnpld
    tvlkvldilgkkfpvtenskgykllppylrviqgdgvdintlqeivegmkqkkwsienvs
    fgsggallqkltrdllncsfkcsyvvtnglgvnvfkdpvadpnkrskkgrlslhrtpagn
    fvtleegkgdleeyghdllhtvfkngkvtksysfdevrknaqln