PDB entry 2h39

View 2h39 on RCSB PDB site
Description: Crystal Structure of an ADP-Glucose Phosphorylase from Arabidopsis thaliana with bound ADP-Glucose
Class: transferase
Keywords: At5g18200, ADP-GLUCOSE, GALT-LIKE, STRUCTURAL GENOMICS FUNCTIONAL FOLLOW-UP STUDY, PROTEIN STRUCTURE INITIATIVE, PSI, CENTER FOR EUKARYOTIC STRUCTURAL GENOMICS, CESG, TRANSFERASE
Deposited on 2006-05-22, released 2006-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.176
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable galactose-1-phosphate uridyl transferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g18200
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FK51
      • engineered (185)
    Domains in SCOPe 2.07: d2h39a1, d2h39a2
  • Chain 'B':
    Compound: Probable galactose-1-phosphate uridyl transferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g18200
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FK51 (Start-350)
      • engineered (185)
    Domains in SCOPe 2.07: d2h39b1, d2h39b2
  • Heterogens: ZN, CL, ADQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h39A (A:)
    mtspshasdrgggdgdsvenqspelrkdpvtnrwvifsparakrptdfkskspqnpnpkp
    sscpfcigreqecapelfrvpdhdpnwklrvienlypalsrnletqstqpetgtsrtivg
    fgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyiqvfknqgasaga
    smshsgsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapf
    aatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplk
    vtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrevslt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h39A (A:)
    spelrkdpvtnrwvifsparakrptdfscpfcigreqecapelfrvpdhdpnwklrvien
    lypalsrnletqsrtivgfgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqh
    dsinyiqvfknqgasagasmshsgsqmmalpvvpptvssrldgtkdyfeetgkcclceak
    skhfvidesshfvsvapfaatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkia
    kqlndppynymihtsplkvtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedva
    kvmrevsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h39B (B:)
    mtspshasdrgggdgdsvenqspelrkdpvtnrwvifsparakrptdfkskspqnpnpkp
    sscpfcigreqecapelfrvpdhdpnwklrvienlypalsrnletqstqpetgtsrtivg
    fgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyiqvfknqgasaga
    smshsgsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapf
    aatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplk
    vtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrevslt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h39B (B:)
    qspelrkdpvtnrwvifsparakrptdfpsscpfcigreqecapelfrvpdhdpnwklrv
    ienlypalsrnletqstrtivgfgfhdvviespvhsiqlsdidpvgigdiliaykkrinq
    iaqhdsinyiqvfknqgasagasmshsgsqmmalpvvpptvssrldgtkdyfeetgkccl
    ceakskhfvidesshfvsvapfaatypfeiwiipkdhsshfhhlddvkavdlggllklml
    qkiakqlndppynymihtsplkvtesqlpythwflqivpqlsgvggfeigtgcyinpvfp
    edvakvmrevslt