PDB entry 2h33

View 2h33 on RCSB PDB site
Description: The Structure of regulator of G-Protein signalling 18 (RGS18) (CASP target)
Class: signaling protein
Keywords: regulator G-protein signalling, helix bundle, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2006-05-22, released 2006-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of G-protein signaling 18
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS18, RGS13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NS28 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d2h33a1, d2h33a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2h33A (A:)
smvspeeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgpqqih
lkakaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqdsytrf
lksdiyldlmegrpqrptnlrrrsrsftcne

    Sequence, based on observed residues (ATOM records): (download) 
    >2h33A (A:)
smvspeeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgpqqih
lkakaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqdsytrf
lksdiyldlmegrp