PDB entry 2h2h

View 2h2h on RCSB PDB site
Description: The Structural basis of sirtuin substrate specificity
Class: Hydrolase
Keywords: H4-K79ac
Deposited on 2006-05-18, released 2006-12-05
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent deacetylase
    Species: Thermotoga maritima
    Gene: npdA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2h2ha1
  • Chain 'B':
    Compound: histone h4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02309
      • engineered (4)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h2hA (A:)
    mkmkefldllnesrltvtltgagistpsgipdfrgpngiykkysqnvfdidffyshpeef
    yrfakegifpmlqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnve
    eyycvrcekkytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssr
    aslmivlgsslvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvm
    eeggis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h2hA (A:)
    mkmkefldllnesrltvtltgagistpsgipdfnvfdidffyshpeefyrfakegifpml
    qakpnlahvllakleekglieavitqnidrlhqragskkvielhgnveeyycvrcekkyt
    vedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssraslmivlgsslv
    vypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvmeeggis
    

  • Chain 'B':
    No sequence available.