PDB entry 2h2f

View 2h2f on RCSB PDB site
Description: The Structural basis for Sirtuin Substrate affinity
Class: Hydrolase
Keywords: Sir2Tm, Hydrolase
Deposited on 2006-05-18, released 2006-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.206
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent deacetylase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: npdA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h2fa_
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h2fA (A:)
    mkmkefldllnesrltvtltgagistpsgipdfrgpngiykkysqnvfdidffyshpeef
    yrfakegifpmlqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnve
    eyycvrcekkytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssr
    aslmivlgsslvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvm
    eeggis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h2fA (A:)
    mkmkefldllnesrltvtltgagistpsgipdqnvfdidffyshpeefyrfakegifpml
    qakpnlahvllakleekglieavitqnidrlhqragskkvielhgnveeyycvrcekkyt
    vedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssraslmivlgsslv
    vypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvmeeggis
    

  • Chain 'B':
    No sequence available.