PDB entry 2h2a

View 2h2a on RCSB PDB site
Description: Crystal structure of Nicotinic acid mononucleotide adenylyltransferase from Staphylococcus aureus: product bound form 2
Class: transferase
Keywords: NadD, NaMNAT, NMNAT, TRANSFERASE
Deposited on 2006-05-18, released 2006-08-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.202
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable nicotinate-nucleotide adenylyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nadD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HFG7 (0-188)
      • modified residue (72)
    Domains in SCOPe 2.01: d2h2aa_
  • Chain 'B':
    Compound: Probable nicotinate-nucleotide adenylyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nadD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HFG7 (0-188)
      • modified residue (72)
    Domains in SCOPe 2.01: d2h2ab_
  • Heterogens: CA, DND, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h2aA (A:)
    mkkivlyggqfnpihtahmivasevfhelqpdefyflpsfmsplkkhhdfidvqhrltmi
    qmiidelgfgdicddeikrggqsytydtikafkeqhkdselyfvigtdqynqlekwyqie
    ylkemvtfvvvnrdknsqnvenamiaiqiprvdisstmirqrvsegksiqvlvpksveny
    ikgeglyeh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h2aB (B:)
    mkkivlyggqfnpihtahmivasevfhelqpdefyflpsfmsplkkhhdfidvqhrltmi
    qmiidelgfgdicddeikrggqsytydtikafkeqhkdselyfvigtdqynqlekwyqie
    ylkemvtfvvvnrdknsqnvenamiaiqiprvdisstmirqrvsegksiqvlvpksveny
    ikgeglyeh