PDB entry 2h29

View 2h29 on RCSB PDB site
Description: Crystal structure of Nicotinic acid mononucleotide Adenylyltransferase from Staphylococcus aureus: product bound form 1
Class: transferase
Keywords: NadD, NaMNAT, NMNAT, TRANSFERASE
Deposited on 2006-05-18, released 2006-08-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable nicotinate-nucleotide adenylyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2h29a_
  • Chain 'B':
    Compound: Probable nicotinate-nucleotide adenylyltransferase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nadD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2h29b_
  • Heterogens: DND, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h29A (A:)
    mkkivlyggqfnpihtahmivasevfhelqpdefyflpsfmsplkkhhdfidvqhrltmi
    qmiidelgfgdicddeikrggqsytydtikafkeqhkdselyfvigtdqynqlekwyqie
    ylkemvtfvvvnrdknsqnvenamiaiqiprvdisstmirqrvsegksiqvlvpksveny
    ikgeglyeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h29A (A:)
    mkkivlyggqfnpihtahmivasevfhelqpdefyflpsfmsplkkhhdfidvqhrltmi
    qmiidelgfgdicddeikrggqsytydtikafkeqhkdselyfvigtdqynqlekwyqie
    ylkemvtfvvvnrdknsqnvenamiaiqiprvdisstmirqrvsegksiqvlvpksveny
    ikgeglye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h29B (B:)
    mkkivlyggqfnpihtahmivasevfhelqpdefyflpsfmsplkkhhdfidvqhrltmi
    qmiidelgfgdicddeikrggqsytydtikafkeqhkdselyfvigtdqynqlekwyqie
    ylkemvtfvvvnrdknsqnvenamiaiqiprvdisstmirqrvsegksiqvlvpksveny
    ikgeglyeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h29B (B:)
    mkkivlyggqfnpihtahmivasevfhelqpdefyflpsfmsplkkhhdfidvqhrltmi
    qmiidelgfgdicddeikrggqsytydtikafkeqhkdselyfvigtdqynqlekwyqie
    ylkemvtfvvvnrdknsqnvenamiaiqiprvdisstmirqrvsegksiqvlvpksveny
    ikgeglye