PDB entry 2h28

View 2h28 on RCSB PDB site
Description: Crystal structure of YeeU from E. coli. Northeast Structural Genomics target ER304
Class: structural genomics, unknown function
Keywords: ER304, E. coli, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-05-18, released 2006-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yeeU
    Species: Escherichia coli [TaxId:562]
    Gene: yeeU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76364 (Start-121)
      • modified residue (69)
      • modified residue (75)
      • modified residue (119)
      • cloning artifact (122-123)
    Domains in SCOPe 2.07: d2h28a1, d2h28a2
  • Chain 'B':
    Compound: Hypothetical protein yeeU
    Species: Escherichia coli [TaxId:562]
    Gene: yeeU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76364
      • modified residue (69)
      • modified residue (75)
    Domains in SCOPe 2.07: d2h28b_
  • Heterogens: CL, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h28A (A:)
    msdtlpgttlpddnhdrpwwglpctvtpcfgarlvqegnrlhyladragirglfsdaday
    hldqafpllmkqlelmltsgelnprhqhtvtlyakgltckadtlsscdyvylavyptpem
    knlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h28A (A:)
    drpwwglpctvtpcfgarlvqegnrlhyladragirglfsdadayhldqafpllmkqlel
    mltsgelnprhqhtvtlyakgltckadtlsscdyvylavyptpemknle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h28B (B:)
    msdtlpgttlpddnhdrpwwglpctvtpcfgarlvqegnrlhyladragirglfsdaday
    hldqafpllmkqlelmltsgelnprhqhtvtlyakgltckadtlsscdyvylavyptpem
    knlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h28B (B:)
    hdrpwwglpctvtpcfgarlvqegnrlhyladragirglfsdadayhldqafpllmkqle
    lmltsgelnprhqhtvtlyakgltckadtlsscdyvylavyptp