PDB entry 2h1v

View 2h1v on RCSB PDB site
Description: Crystal structure of the Lys87Ala mutant variant of Bacillus subtilis ferrochelatase
Class: lyase
Keywords: rossmann fold, pi-helix, lyase
Deposited on 2006-05-17, released 2007-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.13
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrochelatase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: hemH, hemF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32396 (Start-309)
      • engineered (86)
    Domains in SCOPe 2.07: d2h1va_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h1vA (A:)
    msrkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqit
    eqqahnleqhlneiqdeitfkayiglahiepfiedavaemhkdgiteavsivlaphfstf
    svqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamliv
    sahslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltr
    dlfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidal
    atvvlkklgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1vA (A:)
    srkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqite
    qqahnleqhlneiqdeitfkayiglahiepfiedavaemhkdgiteavsivlaphfstfs
    vqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivs
    ahslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrd
    lfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidala
    tvvlkklgr