PDB entry 2h1u

View 2h1u on RCSB PDB site
Description: Porcine pancreatic elastase complexed with MetPheLeuGlu at pH 5.0
Class: hydrolase
Keywords: SERINE PROTEINASE, hydrolase
Deposited on 2006-05-17, released 2006-05-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.184
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elastase-1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00772 (0-239)
      • see remark 999 (65)
    Domains in SCOPe 2.01: d2h1ua_
  • Chain 'P':
    Compound: mfle
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2H1U (0-End)
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2h1uA (A:)
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

  • Chain 'P':
    No sequence available.