PDB entry 2h1p

View 2h1p on RCSB PDB site
Description:
Deposited on 1997-11-12, released 1998-01-28
The last revision prior to the SCOP 1.65 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2h1ph1, d2h1ph2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2h1pl1, d2h1pl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h1pH (H:)
    dvklvesggglvklggslklscaasgftfssyflswvrqtpekrlelvatinsngdktyh
    pdtmkgrftisrdnakntlylqmsslksedtalyycarrdssaslyfdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h1pL (L:)
    dvvmtqtplslpvslgdpasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdkfsgsgsgtdftlkisrveaedqgvyfcsqsthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdedskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec