PDB entry 2h11

View 2h11 on RCSB PDB site
Description: Amino-terminal Truncated Thiopurine S-Methyltransferase Complexed with S-Adenosyl-L-Homocysteine
Class: transferase
Keywords: binary protein-cofactor complex, TRANSFERASE
Deposited on 2006-05-15, released 2006-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.203
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thiopurine s-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: Tpmt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h11a_
  • Chain 'B':
    Compound: thiopurine s-methyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: Tpmt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h11b_
  • Heterogens: SCN, SAH, B3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h11A (A:)
    gstevqknqvltleewqdkwvngktafhqeqghqllkkhldtflkgksglrvffplcgka
    vemkwfadrghsvvgveiselgiqeffteqnlsyseepiteipgtkvfksssgnislycc
    sifdlprtnigkfdmiwdrgalvainpgdrkcyadtmfsllgkkfqyllcvlsydptkhp
    gppfyvphaeierlfgkicnirclekvdafeerhkswgidclfeklylltek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h11A (A:)
    evqknqvltleewqdkwvngktafhqeqghqllkkhldtflkgksglrvffplcgkavem
    kwfadrghsvvgveiselgiqeffteqnlsyseepiteipgtkvfksssgnislyccsif
    dlprtnigkfdmiwdrgalvainpgdrkcyadtmfsllgkkfqyllcvlsydptkhpgpp
    fyvphaeierlfgkicnirclekvdafeerhkswgidclfeklylltek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h11B (B:)
    gstevqknqvltleewqdkwvngktafhqeqghqllkkhldtflkgksglrvffplcgka
    vemkwfadrghsvvgveiselgiqeffteqnlsyseepiteipgtkvfksssgnislycc
    sifdlprtnigkfdmiwdrgalvainpgdrkcyadtmfsllgkkfqyllcvlsydptkhp
    gppfyvphaeierlfgkicnirclekvdafeerhkswgidclfeklylltek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h11B (B:)
    evqknqvltleewqdkwvngktafhqeqghqllkkhldtflkgksglrvffplcgkavem
    kwfadrghsvvgveiselgiqeffteqnlsyseepiteipgtkvfksssgnislyccsif
    dlprtnigkfdmiwdrgalvainpgdrkcyadtmfsllgkkfqyllcvlsydptkhpgpp
    fyvphaeierlfgkicnirclekvdafeerhkswgidclfeklylltek