PDB entry 2h10

View 2h10 on RCSB PDB site
Description: Crystal structure of the M69V E166A double mutant of SHV-1 b-lactamase complexed to tazobactam
Class: hydrolase
Keywords: antibiotic resistance, b-lactamase inhibitor, HYDROLASE
Deposited on 2006-05-15, released 2007-01-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.159
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase SHV-1
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: bla, shv1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AD64 (0-262)
      • engineered (43)
      • engineered (140)
    Domains in SCOPe 2.06: d2h10a_
  • Heterogens: TBE, MA4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2h10A (A:)
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmvstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldrwatelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr