PDB entry 2h0t

View 2h0t on RCSB PDB site
Description: Crystal structure of the M69V E166A double mutant of SHV-1 b-lactamase complexed to clavulanic acid
Class: hydrolase
Keywords: Antibiotic resistance, b-lactamase inhibitor, HYDROLASE
Deposited on 2006-05-15, released 2007-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Broad-spectrum beta-lactamase SHV-1
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaSHV-1, SHV-1b-a, blaSHV-11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5PSW7 (0-262)
      • engineered (43)
      • engineered (140)
    Domains in SCOPe 2.08: d2h0ta_
  • Heterogens: TEM, MA4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2h0tA (A:)
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmvstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldrwatelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr