PDB entry 2h0j

View 2h0j on RCSB PDB site
Description: Crystal structure of PucM in the presence of 5,6-diaminouracil
Class: hydrolase
Keywords: beta sandwitch, complex with diaminouracil, hiu, hydrolase
Deposited on 2006-05-15, released 2006-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin-like protein pucM
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32142 (Start-120)
      • modified residue (7)
      • modified residue (38)
      • modified residue (60)
      • modified residue (66)
    Domains in SCOPe 2.08: d2h0ja_
  • Chain 'B':
    Compound: Transthyretin-like protein pucM
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32142 (Start-120)
      • modified residue (7)
      • modified residue (38)
      • modified residue (60)
      • modified residue (66)
      • modified residue (79)
    Domains in SCOPe 2.08: d2h0jb_
  • Heterogens: URN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h0jA (A:)
    msepeslmgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageel
    msgeyvmefhagdyfasknmnaadqpfltivtvrfqladpdahyhiplllspfgyqvyrg
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h0jA (A:)
    mgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageelmsgeyvm
    efhagdyfasknaadqpfltivtvrfqladpdahyhiplllspfgyqvyrgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h0jB (B:)
    msepeslmgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageel
    msgeyvmefhagdyfasknmnaadqpfltivtvrfqladpdahyhiplllspfgyqvyrg
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h0jB (B:)
    mgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageelmsgeyvm
    efhagdyfasknmnaadqpfltivtvrfqladpdahyhiplllspfgyqvyrgs