PDB entry 2h0i

View 2h0i on RCSB PDB site
Description: Crystal Structure of DsbG V216M mutant
Class: isomerase
Keywords: Thioredoxin fold, Periplasmic disulfide isomerase, Chaperone, Redox-active center, ISOMERASE
Deposited on 2006-05-15, released 2007-04-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol:disulfide interchange protein dsbG
    Species: Escherichia coli [TaxId:562]
    Gene: dsbG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77202
      • engineered (215)
    Domains in SCOPe 2.06: d2h0ia1, d2h0ia2
  • Chain 'B':
    Compound: Thiol:disulfide interchange protein dsbG
    Species: Escherichia coli [TaxId:562]
    Gene: dsbG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77202
      • engineered (215)
    Domains in SCOPe 2.06: d2h0ib1, d2h0ib2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h0iA (A:)
    eelpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekg
    enlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcpyckqfwqqar
    pwvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvste
    qmkvlsdneklmddlganvtpaiyymskentlqqamglpdqktlniimgnkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h0iA (A:)
    elpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekge
    nlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcpyckqfwqqarp
    wvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvsteq
    mkvlsdneklmddlganvtpaiyymskentlqqamglpdqktlniimgn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h0iB (B:)
    eelpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekg
    enlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcpyckqfwqqar
    pwvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvste
    qmkvlsdneklmddlganvtpaiyymskentlqqamglpdqktlniimgnkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h0iB (B:)
    elpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekge
    nlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcpyckqfwqqarp
    wvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvsteq
    mkvlsdneklmddlganvtpaiyymskentlqqamglpdqktlniimgn