PDB entry 2h0f
View 2h0f on RCSB PDB site
Description: Crystal Structure of PucM in the presence of 8-azaxanthine
Class: hydrolase
Keywords: beta sandwitch, inhibitor complex, hiu, hydrolase
Deposited on
2006-05-15, released
2006-06-27
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.208
AEROSPACI score: 0.26
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Transthyretin-like protein pucM
Species: Bacillus subtilis [TaxId:1423]
Database cross-references and differences (RAF-indexed):
- Uniprot O32142 (Start-120)
- modified residue (7)
- modified residue (38)
- modified residue (60)
- modified residue (66)
- Chain 'B':
Compound: Transthyretin-like protein pucM
Species: Bacillus subtilis [TaxId:1423]
Database cross-references and differences (RAF-indexed):
- Uniprot O32142 (Start-120)
- modified residue (7)
- modified residue (38)
- modified residue (60)
- modified residue (66)
- modified residue (79)
Domains in SCOPe 2.02: d2h0fb_ - Heterogens: AZA, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2h0fB (B:)
msepeslmgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageel
msgeyvmefhagdyfasknmnaadqpfltivtvrfqladpdahyhiplllspfgyqvyrg
s
Sequence, based on observed residues (ATOM records): (download)
>2h0fB (B:)
mgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageelmsgeyvm
efhagdyfasknmnaadqpfltivtvrfqladpdahyhiplllspfgyqvyrgs