PDB entry 2h0f

View 2h0f on RCSB PDB site
Description: Crystal Structure of PucM in the presence of 8-azaxanthine
Class: hydrolase
Keywords: beta sandwitch, inhibitor complex, hiu, hydrolase
Deposited on 2006-05-15, released 2006-06-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.208
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin-like protein pucM
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32142 (Start-120)
      • modified residue (7)
      • modified residue (38)
      • modified residue (60)
      • modified residue (66)
  • Chain 'B':
    Compound: Transthyretin-like protein pucM
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32142 (Start-120)
      • modified residue (7)
      • modified residue (38)
      • modified residue (60)
      • modified residue (66)
      • modified residue (79)
    Domains in SCOPe 2.02: d2h0fb_
  • Heterogens: AZA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h0fB (B:)
    msepeslmgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageel
    msgeyvmefhagdyfasknmnaadqpfltivtvrfqladpdahyhiplllspfgyqvyrg
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h0fB (B:)
    mgkltthildltcgkpaanvkiglkrlgesimkevytnndgrvdvpllageelmsgeyvm
    efhagdyfasknmnaadqpfltivtvrfqladpdahyhiplllspfgyqvyrgs