PDB entry 2h04

View 2h04 on RCSB PDB site
Description: Structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors
Class: hydrolase
Keywords: protein tyrosine phosphatase, WPD-loop, sulfamic acid, phosphatase, inhibitor, drug design, HYDROLASE
Deposited on 2006-05-13, released 2006-06-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.17
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein tyrosine phosphatase, receptor type, B,
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2h04a_
  • Heterogens: 4UN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h04A (A:)
    sdrplsvhlnlgqkgnrktscpikinqfeghfmklqadsnyllskeyeelkdvgrnqscd
    iallpenrgknrynnilpydatrvklsnvdddpcsdyinasyipgnnfrreyivtqgplp
    gtkddfwkmvweqnvhnivmvtqcvekgrvkcdhywpadqdslyygdlilqmlsesvlpe
    wtirefkicgeeqldahrlirhfhytvwpdhgvpettqsliqfvrtvrdyinrspgagpt
    vvhcsagvgrtgtfialdrilqqldskdsvdiygavhdlrlhrvhmvqtecqyvylhqcv
    rdvlrarklrseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h04A (A:)
    ktscpikinqfeghfmklqadsnyllskeyeelkdvgrnqscdiallpenrgknrynnil
    pydatrvklsnsdyinasyipgnnfrreyivtqgplpgtkddfwkmvweqnvhnivmvtq
    cvekgrvkcdhywpadqdslyygdlilqmlsesvlpewtirefkicgehrlirhfhytvw
    pdhgvpettqsliqfvrtvrdyinrspgagptvvhcsagvgrtgtfialdrilqqldskd
    svdiygavhdlrlhrvhmvqtecqyvylhqcvrdvlrark