PDB entry 2gzy

View 2gzy on RCSB PDB site
Description: solution structures of the reduced form of thioredoxin from Bacillus subtilis
Class: electron transport
Keywords: alpha/beta, ELECTRON TRANSPORT
Deposited on 2006-05-12, released 2007-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14949 (0-103)
  Domains in SCOPe 2.08: d2gzya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gzyA (A:)
  maivkatdqsfsaetsegvvladfwapwcgpckmiapvleeldqemgdklkivkidvden
  qetagkygvmsiptllvlkdgevvetsvgfkpkealqelvnkhl