PDB entry 2gzw

View 2gzw on RCSB PDB site
Description: Crystal structure of the E.coli CRP-cAMP complex
Class: transcription
Keywords: CRP, CAMP BINDING PROTEIN, TRANSCRIPTION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-05-12, released 2007-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:562]
    Gene: crp, cap, csm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gzwa1, d2gzwa2
  • Chain 'B':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:562]
    Gene: crp, cap, csm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gzwb1, d2gzwb2
  • Chain 'C':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:562]
    Gene: crp, cap, csm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gzwc1, d2gzwc2
  • Chain 'D':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:562]
    Gene: crp, cap, csm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gzwd1, d2gzwd2
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gzwA (A:)
    vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi
    lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm
    arrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsr
    etvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gzwA (A:)
    tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnq
    gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
    tsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgri
    lkmledqnlisahgktivvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gzwB (B:)
    vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi
    lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm
    arrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsr
    etvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gzwB (B:)
    tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnq
    gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
    tsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgri
    lkmledqnlisahgkti
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gzwC (C:)
    vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi
    lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm
    arrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsr
    etvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gzwC (C:)
    tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnq
    gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
    tsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgri
    lkmledqnlisahgktivvy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gzwD (D:)
    vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi
    lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm
    arrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsr
    etvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gzwD (D:)
    tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnq
    gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
    tsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgri
    lkmledqnlisahgktivvygt