PDB entry 2gzu

View 2gzu on RCSB PDB site
Description: High-resolution structure determination of the CylR2 homodimer using intermonomer distances from paramagnetic relaxation enhancement and NMR dipolar couplings
Class: transcription regulator
Keywords: helix-loop-helix DNA binding protein, TRANSCRIPTION REGULATOR
Deposited on 2006-05-12, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-12-23, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytolysin regulator 2
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: cylR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gzua_
  • Chain 'B':
    Compound: cytolysin regulator 2
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: cylR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gzub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gzuA (A:)
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
fqwqpe

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gzuB (B:)
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
fqwqpe