PDB entry 2gzt

View 2gzt on RCSB PDB site
Description: Crystal structure of the HutP antitermination complex bound to the HUT mRNA
Class: transcription/RNA
Keywords: HUTP, RNA BINDING, HUTP-RNA COMPLEX, ANTITERMINATION, TRANSCRIPTION REGULATION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-05-12, released 2007-05-15
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.213
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hut operon positive regulatory protein
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10943 (0-146)
      • engineered (49)
    Domains in SCOP 1.73: d2gzta1
  • Chain 'B':
    Compound: Hut operon positive regulatory protein
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10943 (0-146)
      • engineered (49)
    Domains in SCOP 1.73: d2gztb1
  • Chain 'C':
    Compound: Hut operon positive regulatory protein
    Species: Bacillus subtilis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10943 (0-146)
      • engineered (49)
    Domains in SCOP 1.73: d2gztc1
  • Chain 'D':
    Compound: 5'-r(*up*up*up*ap*gp*up*up*up*up*up*ap*gp*up*up*up*up*up*ap*gp*up*up*u)-3'
  • Heterogens: MG, HIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gztA (A:)
    tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
    gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
    avslygtigapikglehetfgvginhi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gztB (B:)
    tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
    gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
    avslygtigapikglehetfgvginhi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gztC (C:)
    tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
    gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
    avslygtigapikglehetfgvginhi
    

  • Chain 'D':
    No sequence available.