PDB entry 2gzp

View 2gzp on RCSB PDB site
Description: Solution NMR structure of Q8ZP25 from Salmonella typhimurium LT2; Northeast Structural Genomics Consortium Target STR70
Class: structural genomics, unknown function
Keywords: NESG, GFT-NMR, Putative thiol-disulfide isomerase, PSI, Structural Genomics, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2006-05-11, released 2006-06-27
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-27, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative chaperone
    Species: Salmonella typhimurium
    Gene: Q8ZP25
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gzpa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gzpA (A:)
    mandtpfsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiae
    llrefpqfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlm
    rsivdtpaaqetvqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gzpA (A:)
    mandtpfsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiae
    llrefpqfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlm
    rsivdtpaaqetvq