PDB entry 2gzo

View 2gzo on RCSB PDB site
Description: NMR structure of UPF0301 PROTEIN SO3346 from Shewanella oneidensis: Northeast Structural Genomics Consortium target SOR39
Class: structural genomics, unknown function
Keywords: GFT-NMR, PROTEIN STRUCTURE, NESGC, ALPHA-BETA, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-05-11, released 2006-06-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0301 protein SO3346
    Species: Shewanella oneidensis [TaxId:70863]
    Gene: SO3346
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gzoa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gzoA (A:)
    meslqnhfliampslddtffertviylcehdekgamglvinkplgievnslleqmdlpte
    qvsadlamgsqvlmggpvsqdrgfvlhtsqpywanstelgsglmlttsrdvltaigskrs
    pdkflvalgyagwsknqleqeladnswltipadhallfdinhedrwqqasrslgfeawql
    stqaghalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gzoA (A:)
    meslqnhfliampslddtffertviylcehdekgamglvinkplgievnslleqmdlpte
    qvsadlamgsqvlmggpvsqdrgfvlhtsqpywanstelgsglmlttsrdvltaigskrs
    pdkflvalgyagwsknqleqeladnswltipadhallfdinhedrwqqasrslgfeawql
    stqagha