PDB entry 2gzl

View 2gzl on RCSB PDB site
Description: Structure of 2C-methyl-D-erythritol 2,4-clycodiphosphate synthase complexed with a CDP derived fluorescent inhibitor
Class: lyase
Keywords: isoprenoid, lyase, isoprene biosynthesis
Deposited on 2006-05-11, released 2006-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: ispF, mecS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62617 (2-158)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d2gzla2, d2gzla3
  • Heterogens: ZN, 2AA, GPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gzlA (A:)
    lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
    klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
    dlgchmddvnvkattteklgftgrgegiaceavallika