PDB entry 2gzk

View 2gzk on RCSB PDB site
Description: Structure of a complex of tandem HMG boxes and DNA
Class: DNA/structural protein
Keywords: PROTEIN-DNA COMPLEX, HMG BOX, amphoterin
Deposited on 2006-05-11, released 2006-07-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-25, with a file datestamp of 2007-06-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sex-determining region on Y / HMGB1
    Species: Homo sapiens/Rattus rattus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gzka1, d2gzka2
  • Chain 'B':
    Compound: 5'-d(*gp*gp*gp*ap*tp*cp*tp*ap*ap*ap*cp*ap*ap*tp*gp*c)-3'
  • Chain 'C':
    Compound: 5'-d(*gp*cp*ap*tp*tp*gp*tp*tp*tp*ap*gp*ap*tp*cp*cp*c)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gzkA (A:)
    vqdrvkrpmnafivwsrdqrrkmalenprmrnseiskqlgyqwkmlteaekwpffqeaqk
    lqamhrekypnykyrkgetkkkfkdpnapkrppsafflfcseyrpkikgehpglsigdva
    kklgemwnntaaddkqpyekkaaklkekyekdiaayrak
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.