PDB entry 2gz6

View 2gz6 on RCSB PDB site
Description: Crystal Structure Of Anabaena sp. CH1 N-acetyl-D-glucosamine 2-epimerase At 2.0 A
Class: isomerase
Keywords: N-acetyl-D-glucosamine 2-epimerase, Anabaena sp. CH1, ISOMERASE
Deposited on 2006-05-11, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetyl-D-glucosamine 2-epimerase
    Species: Anabaena sp. [TaxId:360069]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gz6a_
  • Chain 'B':
    Compound: N-acetyl-D-glucosamine 2-epimerase
    Species: Anabaena sp. [TaxId:360069]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gz6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gz6A (A:)
    mgknlqalaqlyknallndvlpfwenhsldseggyftcldrqgkvydtdkfiwlqnrqvw
    tfsmlcnqlekrenwlkiarngakflaqhgrddegnwyfaltrggeplvqpynifsdcfa
    amafsqyalasgeewakdvamqaynnvlrrkdnpkgkytktypgtrpmkalavpmilanl
    tlemewllpqetlenvlaatvqevmgdfldqeqglmyenvapdgshidcfegrlinpghg
    ieamwfimdiarrkndsktinqavdvvlnilnfawdneygglyyfmdaaghppqqlewdq
    klwwvhleslvalamgyrltgrdacwawyqkmhdyswqhfadpeygewfgylnrrgevll
    nlkggkwkgcfhvpramylcwqqfeals
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gz6A (A:)
    knlqalaqlyknallndvlpfwenhsldseggyftcldrqgkvydtdkfiwlqnrqvwtf
    smlcnqlekrenwlkiarngakflaqhgrddegnwyfaltrggeplvqpynifsdcfaam
    afsqyalasgeewakdvamqaynnvlrrtrpmkalavpmilanltlemewllpqetlenv
    laatvqevmgdfldqeqglmyenvapdgshidcfegrlinpghgieamwfimdiarrknd
    sktinqavdvvlnilnfawdneygglyyfmdaaghppqqlewdqklwwvhleslvalamg
    yrltgrdacwawyqkmhdyswqhfadpeygewfgylnrrgevllnlkggkwkgcfhvpra
    mylcwqqfeals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gz6B (B:)
    mgknlqalaqlyknallndvlpfwenhsldseggyftcldrqgkvydtdkfiwlqnrqvw
    tfsmlcnqlekrenwlkiarngakflaqhgrddegnwyfaltrggeplvqpynifsdcfa
    amafsqyalasgeewakdvamqaynnvlrrkdnpkgkytktypgtrpmkalavpmilanl
    tlemewllpqetlenvlaatvqevmgdfldqeqglmyenvapdgshidcfegrlinpghg
    ieamwfimdiarrkndsktinqavdvvlnilnfawdneygglyyfmdaaghppqqlewdq
    klwwvhleslvalamgyrltgrdacwawyqkmhdyswqhfadpeygewfgylnrrgevll
    nlkggkwkgcfhvpramylcwqqfeals
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gz6B (B:)
    nlqalaqlyknallndvlpfwenhsldseggyftcldrqgkvydtdkfiwlqnrqvwtfs
    mlcnqlekrenwlkiarngakflaqhgrddegnwyfaltrggeplvqpynifsdcfaama
    fsqyalasgeewakdvamqaynnvlrrkdrpmkalavpmilanltlemewllpqetlenv
    laatvqevmgdfldqeqglmyenvapdgshidcfegrlinpghgieamwfimdiarrknd
    sktinqavdvvlnilnfawdneygglyyfmdaaghppqqlewdqklwwvhleslvalamg
    yrltgrdacwawyqkmhdyswqhfadpeygewfgylnrrgevllnlkggkwkgcfhvpra
    mylcwqqfeals