PDB entry 2gyz

View 2gyz on RCSB PDB site
Description: Crystal structure of human artemin
Class: hormone/growth factor
Keywords: neurotrophic factor, cystine-knot, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2006-05-10, released 2006-06-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.24
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neurotrophic factor artemin isoform 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gyza_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gyzA (A:)
    gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
    pvsqpccrptryeavsfmdvnstwrtvdrlsatacgclghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gyzA (A:)
    gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
    pvsqpccrptryeavsfmdvnstwrtvdrlsatacgc