PDB entry 2gyy

View 2gyy on RCSB PDB site
Description: Structure of aspartate semialdehyde dehydrogenase (ASADH) from Streptococcus pneumoniae
Class: Oxidoreductase
Keywords: Dehydrogenase, Oxidoreductase
Deposited on 2006-05-10, released 2006-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate beta-semialdehyde dehydrogenase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gyya1, d2gyya2
  • Chain 'B':
    Compound: Aspartate beta-semialdehyde dehydrogenase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gyyb1, d2gyyb2
  • Chain 'C':
    Compound: Aspartate beta-semialdehyde dehydrogenase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gyyc1, d2gyyc2
  • Chain 'D':
    Compound: Aspartate beta-semialdehyde dehydrogenase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gyyd1, d2gyyd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gyyA (A:)
    mgytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieettet
    afegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahn
    giiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgv
    kpcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavs
    atcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsr
    dtfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelkle
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gyyA (A:)
    gytvavvgatgavgaqmikmleestlpidkirylasgkslkfkdqditieettetafegv
    dialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahngiiac
    pncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdl
    haeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvr
    ipvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvg
    rirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gyyB (B:)
    mgytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieettet
    afegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahn
    giiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgv
    kpcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavs
    atcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsr
    dtfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelkle
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gyyB (B:)
    gytvavvgatgaqmikmleestlpidkiryldqditieettetafegvdialfsagssts
    akyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahngiiacpncstiqmmval
    epvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlhaeilpsggdkk
    hypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvripvlsahsesvy
    ietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgrirkdldaekgi
    hmwvvsdnllkgaawnsvqiaetlherglvrptaelkfe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gyyC (C:)
    mgytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieettet
    afegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahn
    giiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgv
    kpcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavs
    atcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsr
    dtfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelkle
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gyyC (C:)
    gytvavvgatgavgaqmikmleestlpidkirylgkslkfdqditieettetafegvdia
    lfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahngiiacpnc
    stiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlhae
    ilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvripv
    lsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgrir
    kdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gyyD (D:)
    mgytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieettet
    afegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahn
    giiacpncstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgv
    kpcdlhaeilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavs
    atcvripvlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsr
    dtfvgrirkdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrptaelkfelkle
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gyyD (D:)
    ytvavvgatgavgaqmikmleestlpidkirylgkslkfkdqditieettetafegvdia
    lfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahngiiacpnc
    stiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlhae
    ilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvripv
    lsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgrir
    kdldaekgihmwvvsdnllkgaawnsvqiaetlherglvrpt