PDB entry 2gyt

View 2gyt on RCSB PDB site
Description: Solution structure of the SAM (sterile alpha motif) domain of DLC1 (deleted in liver cancer 1)
Class: protein binding
Keywords: SAM domain, protein structure, PROTEIN BINDING
Deposited on 2006-05-10, released 2007-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Deleted in liver cancer 1 protein, isoform 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96QB1 (0-75)
  Domains in SCOPe 2.08: d2gyta1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gytA (A:)
  mcrkkpdtmiltqieakeacdwlratgfpqyaqlyedflfpidislvkrehdfldrdaie
  alcrrlntlnkcavmk