PDB entry 2gyr

View 2gyr on RCSB PDB site
Description: Crystal structure of human artemin
Class: hormone/growth factor
Keywords: neurotrophic factor, cystein-knot, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2006-05-09, released 2006-06-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.308
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurotrophic factor artemin, isoform 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ARTN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gyra_
  • Chain 'B':
    Compound: Neurotrophic factor artemin, isoform 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ARTN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gyrb_
  • Chain 'C':
    Compound: Neurotrophic factor artemin, isoform 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ARTN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gyrc_
  • Chain 'D':
    Compound: Neurotrophic factor artemin, isoform 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ARTN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gyrd_
  • Chain 'E':
    Compound: Neurotrophic factor artemin, isoform 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ARTN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gyre_
  • Chain 'F':
    Compound: Neurotrophic factor artemin, isoform 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ARTN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2gyrf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gyrA (A:)
    gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
    pvsqpccrptryeavsfmdvnstwrtvdrlsatacgclghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gyrA (A:)
    gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
    pvsqpccrptryeavsfmdvnstwrtvdrlsatacgc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gyrB (B:)
    gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
    pvsqpccrptryeavsfmdvnstwrtvdrlsatacgclghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gyrB (B:)
    gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
    pvsqpccrptryeavsfmdvnstwrtvdrlsatacgc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gyrC (C:)
    gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
    pvsqpccrptryeavsfmdvnstwrtvdrlsatacgclghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gyrC (C:)
    gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
    pvsqpccrptryeavsfmdvnstwrtvdrlsatacgc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gyrD (D:)
    gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
    pvsqpccrptryeavsfmdvnstwrtvdrlsatacgclghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gyrD (D:)
    gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
    pvsqpccrptryeavsfmdvnstwrtvdrlsatacgc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gyrE (E:)
    gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
    pvsqpccrptryeavsfmdvnstwrtvdrlsatacgclghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gyrE (E:)
    gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
    pvsqpccrptryeavsfmdvnstwrtvdrlsatacgc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2gyrF (F:)
    gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
    pvsqpccrptryeavsfmdvnstwrtvdrlsatacgclghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gyrF (F:)
    gcrlrsqlvpvralglghrsdelvrfrfcsgscrrarsphdlslasllgagalrpppgsr
    pvsqpccrptryeavsfmdvnstwrtvdrlsatacgc