PDB entry 2gxq

View 2gxq on RCSB PDB site
Description: HERA N-terminal domain in complex with AMP, crystal form 1
Class: hydrolase
Keywords: RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, HYDROLASE
Deposited on 2006-05-09, released 2006-08-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.137
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat resistant RNA dependent ATPase
    Species: Thermus thermophilus HB27 [TaxId:262724]
    Gene: HERA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2gxqa_
  • Heterogens: AMP, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gxqA (A:)
    mefkdfplkpeilealhgrglttptpiqaaalplalegkdligqartgtgktlafalpia
    erlapsqergrkpralvltptrelalqvaseltavaphlkvvavyggtgygkqkeallrg
    adavvatpgraldylrqgvldlsrvevavldeademlsmgfeeeveallsatppsrqtll
    fsatlpswakrlaerymknpvlinvik