PDB entry 2gx8

View 2gx8 on RCSB PDB site
Description: The Crystal Stucture of Bacillus cereus protein related to NIF3
Class: structural genomics, unknown function
Keywords: Structural Genomics, Unknown function, NIF3 related protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2006-05-08, released 2006-05-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.199
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NIF3-related protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: AAP11199
    Database cross-references and differences (RAF-indexed):
    • GB AAP11199 (Start-396)
    Domains in SCOPe 2.06: d2gx8a1
  • Chain 'B':
    Compound: NIF3-related protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: AAP11199
    Database cross-references and differences (RAF-indexed):
    • GB AAP11199 (Start-396)
    Domains in SCOPe 2.06: d2gx8b_
  • Chain 'C':
    Compound: NIF3-related protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: AAP11199
    Database cross-references and differences (RAF-indexed):
    • GB AAP11199 (Start-396)
    Domains in SCOPe 2.06: d2gx8c_
  • Heterogens: ZN, EPE, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gx8A (A:)
    mhhhhhhssgvdlgtenlyfqsnamskipngheiislfesmypkhlamegdkiglqigal
    nkpvrhvlialdvteevvdeaiqlganviiahhplifnplkaihtdkaygkiiekciknd
    iaiyaahtnvdvakggvndllaealglqntevlaptyaeemkkvvvfvpvthaeevrkal
    gdagaghignyshctfssegtgtfvpqegtnpyigetgqlerveevrietiipaslqrkv
    ikamvtahpyeevaydvypldnkgetlglgkigylqeemtlgqfaehvkqsldvkgarvv
    gklddkvrkvavlggdgnkyinqakfkgadvyvtgdmyyhvahdammlglnivdpghnve
    kvmkqgvqkqlqekvdakklnvhihasqlhtdpfifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx8A (A:)
    ipngheiislfesmypkhlamegdkiglqigalnkpvrhvlialdvteevvdeaiqlgan
    viiahhplifnplkaihtdkaygkiiekcikndiaiyaahtnvdvakggvndllaealgl
    qntevlaptyaeemkkvvvfvpvthaeevrkalgdagaghignyshctfssegtgtfvpq
    qlerveevrietiipaslqrkvikamvtahpyeevaydvypldnkgetlglgkigylqee
    mtlgqfaehvkqsldvkgarvvgklddkvrkvavlggdgnkyinqakfkgadvyvtgdmy
    yhvahdammlglnivdpghnvekvmkqgvqkqlqekvdakklnvhihasqlhtdpfifv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gx8B (B:)
    mhhhhhhssgvdlgtenlyfqsnamskipngheiislfesmypkhlamegdkiglqigal
    nkpvrhvlialdvteevvdeaiqlganviiahhplifnplkaihtdkaygkiiekciknd
    iaiyaahtnvdvakggvndllaealglqntevlaptyaeemkkvvvfvpvthaeevrkal
    gdagaghignyshctfssegtgtfvpqegtnpyigetgqlerveevrietiipaslqrkv
    ikamvtahpyeevaydvypldnkgetlglgkigylqeemtlgqfaehvkqsldvkgarvv
    gklddkvrkvavlggdgnkyinqakfkgadvyvtgdmyyhvahdammlglnivdpghnve
    kvmkqgvqkqlqekvdakklnvhihasqlhtdpfifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx8B (B:)
    skipngheiislfesmypkhlamegdkiglqigalnkpvrhvlialdvteevvdeaiqlg
    anviiahhplifnplkaihtdkaygkiiekcikndiaiyaahtnvdvakggvndllaeal
    glqntevlaptyaeemkkvvvfvpvthaeevrkalgdagaghignyshctfssegtgtfv
    pqqlerveevrietiipaslqrkvikamvtahpyeevaydvypldnkgetlglgkigylq
    eemtlgqfaehvkqsldvkgarvvgklddkvrkvavlggdgnkyinqakfkgadvyvtgd
    myyhvahdammlglnivdpghnvekvmkqgvqkqlqekvdakklnvhihasqlhtdpfif
    v
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gx8C (C:)
    mhhhhhhssgvdlgtenlyfqsnamskipngheiislfesmypkhlamegdkiglqigal
    nkpvrhvlialdvteevvdeaiqlganviiahhplifnplkaihtdkaygkiiekciknd
    iaiyaahtnvdvakggvndllaealglqntevlaptyaeemkkvvvfvpvthaeevrkal
    gdagaghignyshctfssegtgtfvpqegtnpyigetgqlerveevrietiipaslqrkv
    ikamvtahpyeevaydvypldnkgetlglgkigylqeemtlgqfaehvkqsldvkgarvv
    gklddkvrkvavlggdgnkyinqakfkgadvyvtgdmyyhvahdammlglnivdpghnve
    kvmkqgvqkqlqekvdakklnvhihasqlhtdpfifv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx8C (C:)
    skipngheiislfesmypkhlamegdkiglqigalnkpvrhvlialdvteevvdeaiqlg
    anviiahhplifnplkaihtdkaygkiiekcikndiaiyaahtnvdvakggvndllaeal
    glqntevlaptyaeemkkvvvfvpvthaeevrkalgdagaghignyshctfssegtgtfv
    pqeggqlerveevrietiipaslqrkvikamvtahpyeevaydvypldnkgetlglgkig
    ylqeemtlgqfaehvkqsldvkgarvvgklddkvrkvavlggdgnkyinqakfkgadvyv
    tgdmyyhvahdammlglnivdpghnvekvmkqgvqkqlqekvdakklnvhihasqlhtdp
    fifv