PDB entry 2gx6

View 2gx6 on RCSB PDB site
Description: Rational stabilization of E. coli ribose binding protein
Class: sugar binding protein
Keywords: RBP, ribose binding protein, periplasmic binding protein, rational stabilization, SUGAR BINDING PROTEIN
Deposited on 2006-05-08, released 2007-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-ribose-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Gene: rbsB, prlB, rbsP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02925 (1-271)
      • engineered (58)
      • engineered (66)
      • engineered (247)
    Domains in SCOPe 2.07: d2gx6a_
  • Heterogens: RIP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gx6A (A:)
    mkdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgvk
    illinpvdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakk
    agegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnllta
    hpdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdq
    igakgvevadkvlkgekvqakypvdlklvvkqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx6A (A:)
    kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgvki
    llinpvdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
    gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
    pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
    gakgvevadkvlkgekvqakypvdlklvvkq