PDB entry 2gx2

View 2gx2 on RCSB PDB site
Description: Crystal structural and functional analysis of GFP-like fluorescent protein Dronpa
Class: luminescent protein
Keywords: photoswiching, fluorescence protein, LUMINESCENT PROTEIN
Deposited on 2006-05-08, released 2007-05-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fluorescent protein Dronpa
  Species: Echinophyllia sp. SC22 [TaxId:301887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TLG6 (20-End)
    • chromophore (80)
• Chain 'B':
  Compound: Fluorescent protein Dronpa
  Species: Echinophyllia sp. SC22 [TaxId:301887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TLG6
    • chromophore (80)
• Chain 'C':
  Compound: Fluorescent protein Dronpa
  Species: Echinophyllia sp. SC22 [TaxId:301887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TLG6 (20-End)
    • chromophore (80)
• Chain 'D':
  Compound: Fluorescent protein Dronpa
  Species: Echinophyllia sp. SC22 [TaxId:301887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TLG6 (20-End)
    • chromophore (80)
• Chain 'E':
  Compound: Fluorescent protein Dronpa
  Species: Echinophyllia sp. SC22 [TaxId:301887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TLG6 (20-End)
    • chromophore (80)
• Chain 'F':
  Compound: Fluorescent protein Dronpa
  Species: Echinophyllia sp. SC22 [TaxId:301887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TLG6 (20-End)
    • chromophore (80)
• Chain 'G':
  Compound: Fluorescent protein Dronpa
  Species: Echinophyllia sp. SC22 [TaxId:301887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TLG6 (20-End)
    • chromophore (80)
• Chain 'H':
  Compound: Fluorescent protein Dronpa
  Species: Echinophyllia sp. SC22 [TaxId:301887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TLG6 (20-End)
    • chromophore (80)
• Chain 'I':
  Compound: Fluorescent protein Dronpa
  Species: Echinophyllia sp. SC22 [TaxId:301887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TLG6 (20-End)
    • chromophore (80)
• Chain 'J':
  Compound: Fluorescent protein Dronpa
  Species: Echinophyllia sp. SC22 [TaxId:301887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TLG6 (20-End)
    • chromophore (80)
• Chain 'K':
  Compound: Fluorescent protein Dronpa
  Species: Echinophyllia sp. SC22 [TaxId:301887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TLG6
    • chromophore (80)
• Chain 'L':
  Compound: Fluorescent protein Dronpa
  Species: Echinophyllia sp. SC22 [TaxId:301887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TLG6
    • chromophore (80)
  Domains in SCOPe 2.02: d2gx2l_
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  Sequence, based on SEQRES records: (download)
  

  >2gx2L (L:)
  mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
  lkvkeggplpfaydilttvfsygnrvfakypenivdyfkqsfpegyswersmnyedggic
  natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
  sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
  qak
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2gx2L (L:)
  vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
  ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
  vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
  vqlpdyhfvdhhieikshdkdysnvnlhehaeahse