PDB entry 2gx2

View 2gx2 on RCSB PDB site
Description: Crystal structural and functional analysis of GFP-like fluorescent protein Dronpa
Class: luminescent protein
Keywords: photoswiching, fluorescence protein, LUMINESCENT PROTEIN
Deposited on 2006-05-08, released 2007-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (20-End)
      • chromophore (80)
    Domains in SCOPe 2.07: d2gx2a_
  • Chain 'B':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (80)
    Domains in SCOPe 2.07: d2gx2b_
  • Chain 'C':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (20-End)
      • chromophore (80)
    Domains in SCOPe 2.07: d2gx2c_
  • Chain 'D':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (20-End)
      • chromophore (80)
    Domains in SCOPe 2.07: d2gx2d_
  • Chain 'E':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (20-End)
      • chromophore (80)
    Domains in SCOPe 2.07: d2gx2e_
  • Chain 'F':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (20-End)
      • chromophore (80)
    Domains in SCOPe 2.07: d2gx2f_
  • Chain 'G':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (20-End)
      • chromophore (80)
    Domains in SCOPe 2.07: d2gx2g_
  • Chain 'H':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (20-End)
      • chromophore (80)
    Domains in SCOPe 2.07: d2gx2h_
  • Chain 'I':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (20-End)
      • chromophore (80)
    Domains in SCOPe 2.07: d2gx2i_
  • Chain 'J':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (20-End)
      • chromophore (80)
    Domains in SCOPe 2.07: d2gx2j_
  • Chain 'K':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (80)
    Domains in SCOPe 2.07: d2gx2k_
  • Chain 'L':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (80)
    Domains in SCOPe 2.07: d2gx2l_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gx2A (A:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfsygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx2A (A:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gx2B (B:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfsygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx2B (B:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gx2C (C:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfsygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx2C (C:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gx2D (D:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfsygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx2D (D:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gx2E (E:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfsygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx2E (E:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2gx2F (F:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfsygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx2F (F:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2gx2G (G:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfsygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx2G (G:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2gx2H (H:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfsygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx2H (H:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2gx2I (I:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfsygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx2I (I:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2gx2J (J:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfsygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx2J (J:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahselp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2gx2K (K:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfsygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx2K (K:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2gx2L (L:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfsygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx2L (L:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahse