PDB entry 2gx0

View 2gx0 on RCSB PDB site
Description: Crystal structural and functional analysis of GFP-like fluorescent protein
Class: luminescent protein
Keywords: fluorescence, b-can, photoswitching, LUMINESCENT PROTEIN
Deposited on 2006-05-08, released 2007-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (20-End)
      • chromophore (80)
    Domains in SCOPe 2.05: d2gx0a_
  • Chain 'B':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (20-End)
      • chromophore (80)
    Domains in SCOPe 2.05: d2gx0b_
  • Chain 'C':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (20-End)
      • chromophore (80)
    Domains in SCOPe 2.05: d2gx0c_
  • Chain 'D':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (20-End)
      • chromophore (80)
    Domains in SCOPe 2.05: d2gx0d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gx0A (A:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx0A (A:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gx0B (B:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx0B (B:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gx0C (C:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx0C (C:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gx0D (D:)
    mrgshhhhhhgslvprgsmvsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmd
    lkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegyswersmnyedggic
    natnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmal
    sleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahselpr
    qak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gx0D (D:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahselp