PDB entry 2gwp

View 2gwp on RCSB PDB site
Description: High-resolution solution structure of the salt-bridge defficient mouse defensin (E15D)-Cryptdin4
Class: antibiotic
Keywords: triple stranded beta sheet, beta hairpin, ANTIBIOTIC
Deposited on 2006-05-05, released 2006-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Defensin-related cryptdin 4
  Species: Mus musculus [TaxId:10090]
  Gene: Defcr4
  Database cross-references and differences (RAF-indexed):
  • Uniprot P28311 (0-31)
    • engineered (14)
  Domains in SCOPe 2.08: d2gwpa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gwpA (A:)
  gllcycrkghckrgdrvrgtcgirflyccprr