PDB entry 2gw9

View 2gw9 on RCSB PDB site
Description: High-resolution solution structure of the mouse defensin Cryptdin4
Class: antibiotic
Keywords: triple stranded beta sheet, beta hairpin
Deposited on 2006-05-04, released 2006-07-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-10, with a file datestamp of 2007-07-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Defensin-related cryptdin 4
    Species: MUS MUSCULUS
    Gene: Defcr4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gw9a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gw9A (A:)
    gllcycrkghckrgervrgtcgirflyccprr