PDB entry 2gw5

View 2gw5 on RCSB PDB site
Description: Crystal Structure of LIR-2 (ILT4) at 1.8 : differences from LIR-1 (ILT2) in regions implicated in the binding of the Cytomegalovirus class I MHC homolog UL18
Class: Immune system
Keywords: Ig like domains, Immune system
Deposited on 2006-05-03, released 2006-06-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.242
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leukocyte immunoglobulin-like receptor subfamily B member 2 precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: LILRB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2gw5a1, d2gw5a2
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gw5A (A:)
    gtipkptlwaepdsvitqgspvtlscqgsleaqeyrlyrekksaswitrirpelvkngqf
    hipsitwehtgrygcqyysrarwselsdplvlvmtgaypkptlsaqpspvvtsggrvtlq
    cesqvafggfilckegedehpqclnsqphargssraifsvgpvspnrrwshrcygydlns
    pyvwsspsdllellvpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gw5A (A:)
    ipkptlwaepdsvitqgspvtlscqgsleaqeyrlyrekitrirpelvkngqfhipsitw
    ehtgrygcqyysrarwselsdplvlvmtgaypkptlsaqpspvvtsggrvtlqcesqvaf
    ggfilckeqclnsqphargssraifsvgpvspnrrwshrcygydlnspyvwsspsdllel
    lvpg