PDB entry 2gw3

View 2gw3 on RCSB PDB site
Description: Crystal structure of stony coral fluorescent protein Kaede, green form
Class: luminescent protein
Keywords: beta barrel, luminescent protein
Deposited on 2006-05-03, released 2007-05-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.197
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kaede
    Species: Trachyphyllia geoffroyi [TaxId:196280]
    Database cross-references and differences (RAF-indexed):
    • GB BAC20344 (2-End)
      • expression tag (1)
      • chromophore (64)
    Domains in SCOPe 2.03: d2gw3a_
  • Chain 'B':
    Compound: Kaede
    Species: Trachyphyllia geoffroyi [TaxId:196280]
    Database cross-references and differences (RAF-indexed):
    • GB BAC20344 (2-End)
      • expression tag (1)
      • chromophore (64)
    Domains in SCOPe 2.03: d2gw3b_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gw3A (A:)
    apmslikpemkikllmegnvnghqfviegdgkghpfegkqsmdlvvkegaplpfaydilt
    tafhygnrvfakypdhipdyfkqsfpkgfswerslmfedggvciatnditlkgdtffnkv
    rfdgvnfppngpvmqkktlkweastekmylrdgvltgditmalllkgdvhyrcdfrttyk
    srqegvklpgyhfvdhcisilrhdkdynevklyehavahsglpdnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gw3A (A:)
    pmslikpemkikllmegnvnghqfviegdgkghpfegkqsmdlvvkegaplpfaydiltt
    afhygnrvfakypdhipdyfkqsfpkgfswerslmfedggvciatnditlkgdtffnkvr
    fdgvnfppngpvmqkktlkweastekmylrdgvltgditmalllkgdvhyrcdfrttyks
    rqegvklpgyhfvdhcisilrhdkdynevklyehavahsgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gw3B (B:)
    apmslikpemkikllmegnvnghqfviegdgkghpfegkqsmdlvvkegaplpfaydilt
    tafhygnrvfakypdhipdyfkqsfpkgfswerslmfedggvciatnditlkgdtffnkv
    rfdgvnfppngpvmqkktlkweastekmylrdgvltgditmalllkgdvhyrcdfrttyk
    srqegvklpgyhfvdhcisilrhdkdynevklyehavahsglpdnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gw3B (B:)
    pmslikpemkikllmegnvnghqfviegdgkghpfegkqsmdlvvkegaplpfaydiltt
    afhygnrvfakypdhipdyfkqsfpkgfswerslmfedggvciatnditlkgdtffnkvr
    fdgvnfppngpvmqkktlkweastekmylrdgvltgditmalllkgdvhyrcdfrttyks
    rqegvklpgyhfvdhcisilrhdkdynevklyehavahsgl