PDB entry 2gvy

View 2gvy on RCSB PDB site
Description: Monoclinic crystal form of Aspergillus niger alpha-amylase in complex with maltose at 1.8 A resolution
Class: hydrolase
Keywords: (beta-alpha)8 barrel, hydrolase
Deposited on 2006-05-03, released 2006-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase A
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: amy1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gvya1, d2gvya2
  • Chain 'B':
    Compound: alpha-amylase A
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: amy1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gvyb1, d2gvyb2
  • Heterogens: NAG, GLC, BGC, CA, NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gvyA (A:)
    atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
    witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
    nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
    dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
    pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
    fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
    liasanairnyaiskdtgfvtyknwpiykddttiamrkgtdgsqivtilsnkgasgdsyt
    lslsgagytagqqltevigcttvtvgsdgnvpvpmagglprvlypteklagskicsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gvyA (A:)
    atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
    witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
    nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
    dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
    pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
    fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
    liasanairnyaiskdtgfvtyknwpiykddttiamrkgtdgsqivtilsnkgasgdsyt
    lslsgagytagqqltevigcttvtvgsdgnvpvpmagglprvlypteklagskics
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gvyB (B:)
    atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
    witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
    nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
    dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
    pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
    fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
    liasanairnyaiskdtgfvtyknwpiykddttiamrkgtdgsqivtilsnkgasgdsyt
    lslsgagytagqqltevigcttvtvgsdgnvpvpmagglprvlypteklagskicsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gvyB (B:)
    atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
    witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
    nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
    dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
    pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
    fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
    liasanairnyaiskdtgfvtyknwpiykddttiamrkgtdgsqivtilsnkgasgdsyt
    lslsgagytagqqltevigcttvtvgsdgnvpvpmagglprvlypteklagskics