PDB entry 2gvs

View 2gvs on RCSB PDB site
Description: NMR solution structure of CSPsg4
Class: lipid binding protein
Keywords: alpha-coil, LIPID BINDING PROTEIN
Deposited on 2006-05-03, released 2006-09-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chemosensory protein CSP-sg4
  Species: Schistocerca gregaria [TaxId:7010]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O76476 (0-108)
  Domains in SCOPe 2.04: d2gvsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gvsA (A:)
  eekyttkydnvnldeilandrllnkyvqclleddesnctadgkelksvipdalsnecakc
  nekqkegtkkvlkhlinhkpdvwaqlkakydpdgtyskkyedrekelhq