PDB entry 2gvm

View 2gvm on RCSB PDB site
Description: Crystal structure of hydrophobin HFBI with detergent
Class: surface active protein
Keywords: hydrophobin, amphiphile, surfactant, high solvent content, SURFACE ACTIVE PROTEIN
Deposited on 2006-05-03, released 2006-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.233
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrophobin-1
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gvma_
  • Chain 'B':
    Compound: Hydrophobin-1
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gvmb_
  • Chain 'C':
    Compound: Hydrophobin-1
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gvmc_
  • Chain 'D':
    Compound: Hydrophobin-1
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gvmd_
  • Heterogens: ZN, LDA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gvmA (A:)
    sngngnvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccva
    pvagqallcqtavga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gvmA (A:)
    nvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccvapvagq
    allcqtavga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gvmB (B:)
    sngngnvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccva
    pvagqallcqtavga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gvmB (B:)
    nvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccvapvagq
    allcqtavga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gvmC (C:)
    sngngnvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccva
    pvagqallcqtavga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gvmC (C:)
    nvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccvapvagq
    allcqtavga
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gvmD (D:)
    sngngnvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccva
    pvagqallcqtavga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gvmD (D:)
    nvcppglfsnpqccatqvlgligldckvpsqnvydgtdfrnvcaktgaqplccvapvagq
    allcqtavga