PDB entry 2gvk

View 2gvk on RCSB PDB site
Description: Crystal structure of a dye-decolorizing peroxidase (DyP) from Bacteroides thetaiotaomicron VPI-5482 at 1.6 A resolution
Class: oxidoreductase
Keywords: pc04261d, , Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, Heme peroxidase
Deposited on 2006-05-02, released 2006-05-16
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-03, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.165
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme peroxidase
    Species: Bacteroides thetaiotaomicron VPI-5482
    Gene: BT_1219
    Database cross-references and differences (RAF-indexed):
    • GB AAO76326 (Start-316)
      • modified residue (51)
      • modified residue (55)
      • modified residue (62)
      • modified residue (68)
      • modified residue (117)
      • modified residue (147)
      • modified residue (196)
      • modified residue (248)
      • modified residue (275)
      • modified residue (279)
    Domains in SCOP 1.73: d2gvka1
  • Heterogens: CL, NA, UNL, EDO, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gvkA (A:)
    gmnpfqnsfgghipqdvagkqgenvifivynltdspdtvdkvkdvcanfsamirsmrnrf
    pdmqfsctmgfgadawtrlfpdkgkpkelstfseikgekytavstpgdllfhirakqmgl
    cfefasildeklkgavvsvdethgfrymdgkaiigfvdgtenpavdenpyhfavigeeda
    dfaggsyvfvqkyihdmvawnalpveqqekvigrhkfndvelsdeekpgnahnavtnigd
    dlkivranmpfantskgeygtyfigyastfsttrrmlenmfigspagntdrlldfstait
    gtlffvpsydllgelge
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gvkA (A:)
    fgghipqdvagkqgenvifivynltdspdtvdkvkdvcanfsamirsmrnrfpdmqfsct
    mgfgadawtrlfpdkgkpkelstfseikgekytavstpgdllfhirakqmglcfefasil
    deklkgavvsvdethgfrymdgkaiigfvdgtenpavdenpyhfavigeedadfaggsyv
    fvqkyihdmvawnalpveqqekvigrhkfndvelsdeekpgnahnavtnigddlkivran
    mpfantskgeygtyfigyastfsttrrmlenmfigspagntdrlldfstaitgtlffvps
    ydllgelge