PDB entry 2gvh

View 2gvh on RCSB PDB site
Description: Crystal structure of Acyl-CoA hydrolase (15159470) from AGROBACTERIUM TUMEFACIENS at 2.65 A resolution
Class: hydrolase
Keywords: 15159470, Acyl-CoA hydrolase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI
Deposited on 2006-05-02, released 2006-05-30
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-30, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AGR_L_2016p
    Species: Agrobacterium tumefaciens str. C58
    Gene: 15159470
    Database cross-references and differences (RAF-indexed):
    • GB AAK89583
      • modified residue (54)
      • modified residue (110)
      • modified residue (130)
      • modified residue (161)
      • modified residue (176)
      • modified residue (185)
      • modified residue (235)
      • modified residue (261)
    Domains in SCOP 1.73: d2gvha1, d2gvha2
  • Chain 'B':
    Compound: AGR_L_2016p
    Species: Agrobacterium tumefaciens str. C58
    Gene: 15159470
    Database cross-references and differences (RAF-indexed):
    • GB AAK89583
      • modified residue (54)
      • modified residue (110)
      • modified residue (130)
      • modified residue (161)
      • modified residue (176)
      • modified residue (185)
      • modified residue (235)
      • modified residue (261)
    Domains in SCOP 1.73: d2gvhb1, d2gvhb2
  • Chain 'C':
    Compound: AGR_L_2016p
    Species: Agrobacterium tumefaciens str. C58
    Gene: 15159470
    Database cross-references and differences (RAF-indexed):
    • GB AAK89583
      • modified residue (54)
      • modified residue (110)
      • modified residue (130)
      • modified residue (161)
      • modified residue (176)
      • modified residue (185)
      • modified residue (235)
      • modified residue (261)
    Domains in SCOP 1.73: d2gvhc1, d2gvhc2
  • Heterogens: NA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gvhA (A:)
    mgsdkihhhhhhmteiatiekpaqhgattrlidivfpgdtnhhgtlfggtglalmdrvaf
    iaatrfgrtpfvtasceridfrqparighiveftarpvkagrrsltvevemvaetiigrq
    qhtctrgifhmvaipegedaasyvlpellteetpdpsdavtmveivfpdqansagrmfgg
    eaiaymtkaafvaasrycgklvvlasseridfaraieigeiveaqahvervgrssmsiqt
    klwsenlltgerhitatghftmvavdkdhrpatirdpaeafslekgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gvhA (A:)
    kpaqhgattrlidivfpgdtnhhgtlfggtglalmdrvafiaatrfgrtpfvtascerid
    frqparighiveftarpvkagrrsltvevemvaetiigrqqhtctrgifhmvaipegeda
    asyvlpellteetpdavtmveivfpdqansagrmfggeaiaymtkaafvaasrycgklvv
    lasseridfaraieigeiveaqahvervgrssmsiqtklwsenlltgerhitatghftmv
    avdrpati
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gvhB (B:)
    mgsdkihhhhhhmteiatiekpaqhgattrlidivfpgdtnhhgtlfggtglalmdrvaf
    iaatrfgrtpfvtasceridfrqparighiveftarpvkagrrsltvevemvaetiigrq
    qhtctrgifhmvaipegedaasyvlpellteetpdpsdavtmveivfpdqansagrmfgg
    eaiaymtkaafvaasrycgklvvlasseridfaraieigeiveaqahvervgrssmsiqt
    klwsenlltgerhitatghftmvavdkdhrpatirdpaeafslekgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gvhB (B:)
    paqhgattrlidivfpgdtnhhgtlfggtglalmdrvafiaatrfgrtpfvtasceridf
    rqparighiveftarpvkagrrsltvevemvaetiigrqqhtctrgifhmvaipegedaa
    syvlpellteetpdpsdavtmveivfpdqansagrmfggeaiaymtkaafvaasrycgkl
    vvlasseridfaraieigeiveaqahvervgrssmsiqtklwsenlltgerhitatghft
    mvavdrpati
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gvhC (C:)
    mgsdkihhhhhhmteiatiekpaqhgattrlidivfpgdtnhhgtlfggtglalmdrvaf
    iaatrfgrtpfvtasceridfrqparighiveftarpvkagrrsltvevemvaetiigrq
    qhtctrgifhmvaipegedaasyvlpellteetpdpsdavtmveivfpdqansagrmfgg
    eaiaymtkaafvaasrycgklvvlasseridfaraieigeiveaqahvervgrssmsiqt
    klwsenlltgerhitatghftmvavdkdhrpatirdpaeafslekgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gvhC (C:)
    iekpaqhgattrlidivfpgdtnhhgtlfggtglalmdrvafiaatrfgrtpfvtascer
    idfrqparighiveftarpvkagrrsltvevemvaetiigrqqhtctrgifhmvaipege
    daasyvlpellteetpdavtmveivfpdqansagrmfggeaiaymtkaafvaasrycgkl
    vvlasseridfaraieigeiveaqahvervgrssmsiqtklwsenlltgerhitatghft
    mvavdrpati