PDB entry 2gvc

View 2gvc on RCSB PDB site
Description: Crystal structure of flavin-containing monooxygenase (FMO)from S.pombe and substrate (methimazole) complex
Class: oxidoreductase
Keywords: FMO, FAD, methimazole, oxygenase, PSI, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, OXIDOREDUCTASE
Deposited on 2006-05-02, released 2006-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.23
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monooxygenase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HFE4
      • modified residue (96)
      • modified residue (376)
      • modified residue (385)
      • modified residue (432)
    Domains in SCOPe 2.07: d2gvca1, d2gvca2
  • Chain 'B':
    Compound: monooxygenase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HFE4
      • modified residue (96)
      • modified residue (376)
      • modified residue (385)
      • modified residue (432)
    Domains in SCOPe 2.07: d2gvcb1, d2gvcb2
  • Chain 'D':
    Compound: monooxygenase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HFE4
      • modified residue (96)
      • modified residue (376)
      • modified residue (385)
      • modified residue (432)
    Domains in SCOPe 2.07: d2gvcd1, d2gvcd2
  • Chain 'E':
    Compound: monooxygenase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HFE4
      • modified residue (96)
      • modified residue (376)
      • modified residue (385)
      • modified residue (432)
    Domains in SCOPe 2.07: d2gvce1, d2gvce2
  • Heterogens: PEO, FAD, MMZ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gvcA (A:)
    mclptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvp
    stnpilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqey
    qriyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpy
    ipnikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiy
    qsllgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyctgylysvpfpsla
    klkspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqaqaaflarvwsgr
    lklpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpvleeefpsp
    ywgekersirenmwsirakffgieppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gvcA (A:)
    lptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvpst
    npilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqeyqr
    iyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpyip
    nikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiyqs
    llgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyctgylysvpfpslakl
    kspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqaqaaflarvwsgrlk
    lpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpvleeefpspyw
    gekersirenmwsirakffgie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gvcB (B:)
    mclptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvp
    stnpilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqey
    qriyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpy
    ipnikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiy
    qsllgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyctgylysvpfpsla
    klkspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqaqaaflarvwsgr
    lklpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpvleeefpsp
    ywgekersirenmwsirakffgieppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gvcB (B:)
    lptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvpst
    npilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqeyqr
    iyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpyip
    nikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiyqs
    llgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyctgylysvpfpslakl
    kspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqaqaaflarvwsgrlk
    lpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpvleeefpspyw
    gekersirenmwsirakffgie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gvcD (D:)
    mclptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvp
    stnpilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqey
    qriyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpy
    ipnikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiy
    qsllgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyctgylysvpfpsla
    klkspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqaqaaflarvwsgr
    lklpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpvleeefpsp
    ywgekersirenmwsirakffgieppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gvcD (D:)
    lptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvpst
    npilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqeyqr
    iyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpyip
    nikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiyqs
    llgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyctgylysvpfpslakl
    kspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqaqaaflarvwsgrlk
    lpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpvleeefpspyw
    gekersirenmwsirakffgie
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gvcE (E:)
    mclptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvp
    stnpilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqey
    qriyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpy
    ipnikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiy
    qsllgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyctgylysvpfpsla
    klkspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqaqaaflarvwsgr
    lklpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpvleeefpsp
    ywgekersirenmwsirakffgieppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gvcE (E:)
    lptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvpst
    npilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqeyqr
    iyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpyip
    nikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiyqs
    llgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyctgylysvpfpslakl
    kspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqaqaaflarvwsgrlk
    lpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpvleeefpspyw
    gekersirenmwsirakffgie